PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G15550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 342aa    MW: 37495.8 Da    PI: 9.0597
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G15550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-311972255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  OPUNC10G15550.1 19 PRLRWTPDLHHCFVHAIHKLGGQHKATPKRVLQLMGVGGLTISHVKSHLQMYRN 72
                     8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8941575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-301574IPR009057Homeodomain-like
SuperFamilySSF466891.97E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-241972IPR006447Myb domain, plants
PfamPF002496.4E-102071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVRRERIEGV RQYNRSKVPR LRWTPDLHHC FVHAIHKLGG QHKATPKRVL QLMGVGGLTI  60
SHVKSHLQMY RNMRNDDLGM QGIQQMDDQE QTFAGGMQIW TDMQQQDHHH ECNGPYCRCH  120
TSSKHAKGSL LLLHHQQQQQ QLQRPNEMET RQGTSTQTSF LRSQGIRERD VSSGLPVPGQ  180
PAGYYSYYTP MAPDESSPRR HRRPAWPHHG APPAAAADGA GHDDAAPPPR LLGLVVMTTT  240
RRGSREEHDE ATPPVNGARN GKARRMAAAE ERDGDELSLS LTLDSGLSCR SSGGGAYCCS  300
EGSSSNWLSS PSSTSSGGGG AGGGFSRRSP AMLNSVSLDL SL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126181e-91CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572016.31e-62PREDICTED: uncharacterized protein LOC100832345
TrEMBLA0A0E0MA910.0A0A0E0MA91_ORYPU; Uncharacterized protein
STRINGLOC_Os10g39550.11e-165(Oryza sativa Japonica Group)
STRINGORGLA10G0122800.11e-165(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-29G2-like family protein